PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.W3SAL
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 576aa    MW: 65323.2 Da    PI: 5.4588
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.W3SALgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.61.2e-12150191345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       W ++E+ ll+++++++G g+W+ +a+++g +++  qc+++++
      Aradu.W3SAL 150 DWNADEEMLLLEGIEMYGFGNWNEVAEYVG-TKSKSQCIDHYN 191
                      6*****************************.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0250245.3E-13479576IPR016827Transcriptional adaptor 2
SMARTSM002911.6E-987132IPR000433Zinc finger, ZZ-type
SuperFamilySSF578507.18E-1591154No hitNo description
PROSITE profilePS5013510.6191134IPR000433Zinc finger, ZZ-type
CDDcd023352.05E-2691139No hitNo description
PfamPF005693.6E-991131IPR000433Zinc finger, ZZ-type
PROSITE patternPS01357093120IPR000433Zinc finger, ZZ-type
SuperFamilySSF466894.49E-13143197IPR009057Homeodomain-like
PROSITE profilePS5129322.397146198IPR017884SANT domain
SMARTSM007177.1E-12147196IPR001005SANT/Myb domain
PfamPF002499.4E-13150191IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-8151193IPR009057Homeodomain-like
CDDcd001676.97E-12151191No hitNo description
SuperFamilySSF466891.31E-5508572IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009409Biological Processresponse to cold
GO:0016573Biological Processhistone acetylation
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 576 aa     Download sequence    Send to blast
MLEEGIGWDE MDLMLSMSTR FPQYIVFTNQ GEPSFDLHLN LCLSFTTGCD IKLEPTSRSK  60
KKKAALNVEN LDTSSPDVAA QGVTDGKGAL YHCNYCNKDI SGMIRIKCAV CQDFDLCIEC  120
FSVGAEVTPH KSNHPYMIMD NLSFPLITPD WNADEEMLLL EGIEMYGFGN WNEVAEYVGT  180
KSKSQCIDHY NAIYMNSPCF PLPDLSHVMG KNKEELLEMA KGHEVKKGLF LYNLKSQFLE  240
IISEESNRAE VTNPTSMLTS VCGKTYSSTI KKASNVSQNA DGVKVEDRSI GEKKPKLSGK  300
VEPSVTELSG YSFKREEFEI EYDNDAEQVL ADMEFKDIDT ESEREMKLHV LHIYSRRLDE  360
RKRRKNFILE RNLLYPDPFE KSLSPEEVEI CQRYKVFTRF HSKEEHMELL KNIIEEHRLI  420
KRIQDLQEAH TAGYQTSTEA YKFIEQKKKE AERVVKENNH IGVGAKILPR PNYLKGELDS  480
NSLGLHKDIT APLSGVKYPA AAIQDISRSL EEWDISGFAG AELLSESVSS LNVLSSEISK  540
GNISKKCDAH RLFKVEPSKV DRVYDMLIKK GIASSN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150382e-36AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016204442.10.0PREDICTED: transcriptional adapter ADA2a-like
SwissprotQ75LL61e-179TADA2_ORYSJ; Transcriptional adapter ADA2
TrEMBLK7LYC20.0K7LYC2_SOYBN; Uncharacterized protein
STRINGGLYMA13G11200.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15371726